Tap / click on image to see more RealViewsTM
CA$10.90
per sheet of 20
 

Caduceus Classic Round Sticker

Qty:
Classic Round Stickers
+CA$0.45
+CA$0.45
+CA$0.45

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" diameter, 6 stickers per sheet
    • Small: 1.5" diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Caduceus Classic Round Sticker

Caduceus Classic Round Sticker

Design that makes caduceus motif

Customer Reviews

4.8 out of 5 stars rating26.9K Total Reviews
23349 total 5-star reviews2218 total 4-star reviews537 total 3-star reviews317 total 2-star reviews470 total 1-star reviews
26,891 Reviews
Reviews for similar products
4 out of 5 stars rating
By Ellie M.May 2, 2022Verified Purchase
Zazzle Reviewer Program
I loved the stickers but wished there was more gold shimmer on all gold colored edges and on cross and on flowers. I should of ordered them a little larger. The printing was alright, wish they were a little more bold though. Looked a little faded.
5 out of 5 stars rating
By Dewi P.December 17, 2021Verified Purchase
Zazzle Reviewer Program
It is as expected when it's arrived. The stickers meet my need. Classy, simple and elegant. I satisfied with the printing quality. And I received a lot of compliments for the stickers.
5 out of 5 stars rating
By Youmeus P.November 26, 2020Verified Purchase
Zazzle Reviewer Program
Effective sticker. Easy to peal off. A nice touch when sending mail. Colour and size as described. Clear.

Tags

Stickers
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 217176518511647409
Designed on 2010-04-26, 7:47 AM
Rating: G