Tap / click on image to see more RealViewsTM
Sale Price CA$40.99.  
Original Price CA$54.65 per pack of 100
You save 25% ends today

Caduceus Business Card

Qty:
Squared
+CA$10.55
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-CA$10.55
-CA$10.55
+CA$10.50
+CA$10.50
+CA$10.50

Other designs from this category

About Business Cards

Sold by

Size: Canadian Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full colour CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating39K Total Reviews
32690 total 5-star reviews3886 total 4-star reviews964 total 3-star reviews588 total 2-star reviews859 total 1-star reviews
38,987 Reviews
5 out of 5 stars rating
By n.April 7, 2015Verified Purchase
Business Card, Size: Canadian Standard, 3.5" x 2.0",Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Lori B.May 18, 2022Verified Purchase
Business Card, Size: Canadian Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The cards turned out lovely! Just enough colour and design to look good and be easy to read . Sturdy card stock as well. The soft pink watercolour looks really pretty on it! Printing is very nice. It’s clear and well designed
5 out of 5 stars rating
By Marie S.July 2, 2022Verified Purchase
Business Card, Size: Mighty, 3.5" x 2.5",Paper: Signature Matte, Corners: Rounded
Zazzle Reviewer Program
I am so happy with these custom earring card backs. The process of designing then was easy and straightforward. There was an error with my initial order due and they refunded me and printed again right away. My cards are sleek, professional and perfect for my small business. They arrive promptly. I am very pleased to also be supporting other independent creatives like myself.. The print quality was exceptional!

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Designed on 2010-04-25, 1:11 PM
Rating: G