Tap / click on image to see more RealViewsTM
Sale Price CA$4.26.  
Original Price CA$5.68 per card
You save 25%

Caduceus

Qty:
Squared
Basic Semi-Gloss
16 pt thickness / 150 lb weight Bright white, smooth texture

About Flat Cards

Sold by

Size: 10.2 cm x 22.9 cm

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 10.2 cm x 22.9 cm (portrait or landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Basic Semi-Gloss

Bright, smooth, and polished—our Basic Semi-Gloss paper brings your design to life with vibrant colour and a subtle shine. It’s the perfect choice for everyday elegance and budget-friendly celebrations.

About This Design

Caduceus

Caduceus

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.4K Total Reviews
2084 total 5-star reviews163 total 4-star reviews42 total 3-star reviews28 total 2-star reviews82 total 1-star reviews
2,399 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Raylene W.December 9, 2024Verified Purchase
Flat Card, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Corner: Squared
Received my order and it was perfect! Would definitely buy again and recommend to anyone. Thanks so much!
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousJuly 29, 2025Verified Purchase
Flat Card, Size: 8.9 cm x 12.7 cm, Paper: Signature Matte, Corner: Squared
I had ordered memorial cards for my mother’s funeral. I started to panic that I wouldn’t get them in time. The Zazzle team made it happen! They are amazing! They truly are a family company that demonstrates care & compassion to their customers. Plus, the cards are perfect!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ashley H.November 18, 2023Verified Purchase
Flat Card, Size: 20.3 cm x 10.2 cm, Paper: Basic Semi-Gloss, Corner: Squared
Zazzle Reviewer Program
These gift certificates are so perfect. I will definitely be ordering more!! Printing was perfect and the quality was very clear. Very happy with it!

Tags

Flat Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 245343749875724602
Designed on 2010-04-25, 1:54 PM
Rating: G