Tap / click on image to see more RealViewsTM
CA$71.83
each
 

Bottlenose Dolphins Ocean Fish Guest Book

Qty:
26.7 cm × 21 cm
-CA$15.99
+CA$31.96
Lined White 70# Uncoated Text

Other designs from this category

About Guest Books

Sold by

Style: 26.7 cm × 21 cm Guestbook

Crafted with meticulous attention to detail, these guest books are designed to elevate your special occasions, capturing memories with style and grace. The guest book features a cover made from premium paper, exuding an aura of elegance. The cover is further enhanced with a luxurious velvet lamination, adding a tactile charm that begs to be touched and admired. Inside, you'll find a harmonious blend of quality and aesthetics. The white lined pages are crafted from 100gsm uncoated text, providing a smooth surface that welcomes every stroke of the pen with grace and finesse. These pages serve as the canvas for your guests' heartfelt messages, well wishes, and memories, ensuring every word is captured with clarity and precision. For a touch of contrast, optional black pages made from 90gsm Eclipse paper create a striking backdrop for metallic and gel ink pens, allowing your guests' words to shine brightly against the darkness.

  • Dimensions: 21cm x 26.7cm (100 Pages)
  • Cover: 150gsm Mohawk uncoated text with velvet lamination
  • Internal Paper: White lined and unlined pages: 100gsm uncoated text, Black unlined pages: 90gsm Eclipse

About This Design

Bottlenose Dolphins Ocean Fish Guest Book

Bottlenose Dolphins Ocean Fish Guest Book

Gorgeous Ocean Underwater scene by Ronald Heinrich with Bottlenose Dolphins, Turtles and Fish with crashing waves and island Palm Trees above the waterline is on this Guest Book. Image is public domain due to released copyright.

Customer Reviews

4.8 out of 5 stars rating702 Total Reviews
641 total 5-star reviews34 total 4-star reviews9 total 3-star reviews8 total 2-star reviews10 total 1-star reviews
702 Reviews
5 out of 5 stars rating
By Patty f.March 5, 2019Verified Purchase
Size: 26.7 cm × 21 cm , Paper: Lined White 70# Uncoated Text
Creator Review
The Book itself is absolutely wonderful. Sturdy and shiny and wonderful. I am actually going to use it as a journal which is why I removed the Guest Book words myself. Easy to add yourself it you want them back on. The Box it comes in just makes it a wonderful gift. Great Book. The printing turned out perfect. The colors are exactly like the image, the Dolphins swim towards you almost like in 3D. Great job printing!!!
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By A.August 19, 2021Verified Purchase
Size: 26.7 cm × 21 cm , Paper: Lined White 70# Uncoated Text
Zazzle Reviewer Program
This book is stunning! I definitely would recommend this product! I love love it! I can not wait for our guests to sign our personalized wedding guest book. Amazing everything about this was amazing! The timing for our book came in earlier than expected.
4 out of 5 stars rating
By Fitzayn Q.July 16, 2021Verified Purchase
Size: 26.7 cm × 21 cm , Paper: Lined White 70# Uncoated Text
Zazzle Reviewer Program
Got my order on time, it was pretty & fabulous. My only concern was the box cover has a little damaged but it’s okay. The book was still in good condition. Good quality & there’s no errors.

Tags

Guest Books
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic
All Products
dolphinsoceanguest bookfishturtleswavesislandswildlifeanimalsaquatic

Other Info

Product ID: 256594565573721818
Designed on 2019-02-16, 1:05 AM
Rating: G