Tap / click on image to see more RealViewsTM
Sale Price CA$2.94.  
Original Price CA$4.19 per card
You save 30%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.91
-CA$0.24

Other designs from this category

About Invitations

Sold by

Size: 5" x 7"

Make custom invitations and announcements for every special occasion! Choose from twelve unique paper types, two printing options, and six shape options to design a card that's perfect for you.

  • Dimensions: 5" x 7" (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Two printing options available: Standard and High-Definition
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 5" x 7". For best results please add 1/16" bleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating32.9K Total Reviews
28973 total 5-star reviews2919 total 4-star reviews505 total 3-star reviews234 total 2-star reviews299 total 1-star reviews
32,930 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim B.February 18, 2022Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I was very impressed with the quality of the invitations especially when I like to look and touch any product I buy. They are very elegant and good quality. They arrive exactly like promised and packaged well as there was no damage. Great Job!! Very satisfied with the quality. Job well done!
5 out of 5 stars rating
By N.August 12, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I am so happy with Zazzle and the designs available for customisation are so unique and classy. Customer service also is great. Highly recommended! The printing as expected. Excellent quality!
5 out of 5 stars rating
By S.April 13, 2020Verified Purchase
Flat Invitation, Size: 5" x 7", Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Our cards were exactly what I hoped they would be. Gorgeous cardstock, beautiful colours (exactly as pictured), and excellent quality! The image quality and colours were pristine.

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Designed on 2024-09-27, 8:23 AM
Rating: G