Tap / click on image to see more RealViewsTM
Sale Price CA$3.15.  
Original Price CA$4.19 per card
You save 25%

Black White Simple Minimalist Elegant Wedding Invitation

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.91
-CA$0.24

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Black White Simple Minimalist Elegant Wedding Invitation

Black White Simple Minimalist Elegant Wedding Invitation

Celebrate your love with this Modern Black & White Minimalist Wedding Invitation, combining sleek design with natural elegance. Featuring clean lines, a refined serif typeface, and a tasteful white leaf motif at the base, this invitation is ideal for contemporary couples who appreciate understated beauty. With a solid dark background and elegant white typography, the design is both modern and timeless. The minimalist border and leaf accent add a subtle organic touch—perfect for garden weddings, modern ceremonies, or eco-conscious celebrations.

Customer Reviews

4.8 out of 5 stars rating33.1K Total Reviews
29094 total 5-star reviews2921 total 4-star reviews515 total 3-star reviews240 total 2-star reviews317 total 1-star reviews
33,087 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kim B.February 18, 2022Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I was very impressed with the quality of the invitations especially when I like to look and touch any product I buy. They are very elegant and good quality. They arrive exactly like promised and packaged well as there was no damage. Great Job!! Very satisfied with the quality. Job well done!
5 out of 5 stars rating
By N.August 12, 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
I am so happy with Zazzle and the designs available for customisation are so unique and classy. Customer service also is great. Highly recommended! The printing as expected. Excellent quality!
5 out of 5 stars rating
By S.April 13, 2020Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Zazzle Reviewer Program
Our cards were exactly what I hoped they would be. Gorgeous cardstock, beautiful colours (exactly as pictured), and excellent quality! The image quality and colours were pristine.

Tags

All Products
minimalistcontemporaryelegantstylishsimplesleekchicfashionabletrendysophisticated

Other Info

Product ID: 256748467101373100
Designed on 2024-09-27, 8:23 AM
Rating: G