Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$12.10
per sticker
 

Black Bear Silhouettes Wildlife Vinyl Sticker Set

4.6 out of 5 stars rating
1062 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Medium 15.24 cm x15.24 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 15.24 cm L x 16.51 cm H
  • Design Area: 15.24 cm L x 15.24 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Wildlife Vinyl Sticker Set

Black Bear Silhouettes Oval and Die Cut Vinyl Stickers. Stick these black bear vinyl decals to your laptop, phone, notebook, water bottle, bicycle helmet, skateboard, guitar case or even your car. These durable wildlife stickers are waterproof and fade proof. A cool design for explorers who enjoy hiking, camping, and travelling to national parks. Available in assorted sizes up to 14” wide. Visit Jenn's Doodle World for even more nature stickers and animal silhouette stickers and accessories.
Jenn's Doodle World
Pro
Artwork designed by
Orange County, CA, United States
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
886 total 5-star reviews70 total 4-star reviews25 total 3-star reviews20 total 2-star reviews61 total 1-star reviews
1,062 Reviews
5 out of 5 stars rating
By Barbara D.July 15, 2020 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Sticks really well on licence plate. Print turned out really cute.
from zazzle.com (US)
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.

Tags

Custom-Cut Vinyl Stickers
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks
All Products
black bearbearsilhouettewildlifeanimalwildcampinghikingoutdoorsnational parks

Other Info

Product ID: 256980266642531566
Designed on 2019-03-22, 10:17 PM
Rating: G