Tap / click on image to see more RealViewsTM
CA$41.45
per sticker
 

Bismarck - Battleship Blueprint Plans BD

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 35.56 cm x 35.56 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 35.6 cm L x 14.12.7 cm W
  • Design Area: 35.6 cm L x 35.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Bismarck - Battleship Blueprint Plans BD

Bismarck - Battleship Blueprint Plans BD

Bismarck the Iconic World War II Battleship of the Kriegsmarine, the German War Navy

Customer Reviews

4.5 out of 5 stars rating1.2K Total Reviews
921 total 5-star reviews74 total 4-star reviews28 total 3-star reviews32 total 2-star reviews95 total 1-star reviews
1,150 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.

Tags

Custom-Cut Vinyl Stickers
bismarckworld war iibattleshipwarshipshipnavykriegsmarinegermanblueprintplans
All Products
bismarckworld war iibattleshipwarshipshipnavykriegsmarinegermanblueprintplans

Other Info

Product ID: 256417789822892099
Designed on 2024-10-11, 1:52 AM
Rating: G