Tap / click on image to see more RealViewsTM
Sale Price CA$2.95.  
Original Price CA$3.93 per card
You save 25%

Baby Girl Shower Invitation Coquette Bow Aesthetic

Qty:
Choose Your Format
Squared
+CA$0.35
Signature Matte
Overall Pick
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-CA$0.23
+CA$0.87

Other designs from this category

About Invitations

Sold by

Size: 12.7 cm x 17.8 cm

Make custom invitations and announcements for every special occasion! Choose from multiple unique paper types, printing options, and shapes to design a card that's perfect for you.

  • Dimensions: 12.7 cm x 17.8 cm (portrait or landscape)
  • Standard white envelope included
  • High quality, full-colour, full-bleed
  • Add photos and text to both sides of this flat card at no extra charge
  • Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 12.7 cm x 17.8 cm. For best results please add 0.15 cmbleed.

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Baby Girl Shower Invitation Coquette Bow Aesthetic

Baby Girl Shower Invitation Coquette Bow Aesthetic

Celebrate your little one in style with this coquette-inspired baby shower invitation featuring soft shades of pink, a delicate lined background, and a charming bow design for that timeless feminine touch. Perfect for moms-to-be who love the romantic coquette aesthetic, this invitation blends elegance, sweetness, and modern charm. Whether you’re planning a classic pink baby shower, a girly tea party theme, or a stylish bow-inspired celebration, this design sets the tone for a beautiful gathering. The blush tones and dainty details make it a versatile choice for baby girls, while the pretty bow motif adds a touch of vintage-inspired grace.

Customer Reviews

4.8 out of 5 stars rating11.1K Total Reviews
10000 total 5-star reviews802 total 4-star reviews132 total 3-star reviews63 total 2-star reviews122 total 1-star reviews
11,119 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousDecember 1, 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Invitations were elegant and just beautiful Exactly what we wanted from the invitations. Everyone luv them and describe them as elegant and unique .
5 out of 5 stars rating
By Andrea S.June 19, 2024Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
- matched theme perfectly - colours vivid - looks exactly as seen - sturdy paper. - clear - neat - easy to read
5 out of 5 stars rating
By AnonymousSeptember 6, 2025Verified Purchase
Flat Invitation, Size: 12.7 cm x 17.8 cm, Paper: Signature Matte, Envelopes: White
Very quick delivery and beautiful cards! .

Tags

Invitations
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage
All Products
pinkbowcoquettebabyshowernewarrivaldaintyfemininevintage

Other Info

Product ID: 256578938762529566
Designed on 2025-09-22, 11:50 AM
Rating: G