Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$4.15
per sticker
 

Autocollant Bigfoot

4.9 out of 5 stars rating
40 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Tiny 5 cm x 5 cm

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 5.08 cm L x 6.35 cm H
  • Design Area: 5.08 cm L x 5.08 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Autocollant Bigfoot

Autocollant Bigfoot

Mysterious Bigfoot Sticker - The Guardian of the Forest Add a mystical, wild touch to your collection with this unique Bigfoot sticker. Depicting the legendary man of the woods in an imposing, enigmatic pose. This captivating design is inspired by the darkest and most intriguing tales of the North American forests. With its piercing red eyes and misty surroundings, this Bigfoot evokes a presence both frightening and fascinating.” Dimensions: Ideal size for personalizing laptops, water bottles, notebooks or any smooth surface. Quality material: Water-resistant and durable for extended use. Why buy it? Perfect for fans of folklore, mystery and wilderness adventures. An ideal gift for Bigfoot and cryptid enthusiasts, or anyone who wants a unique and intriguing touch on their personal items. “Bring mystery into your everyday life. Order your Bigfoot sticker today and let this forest guardian protect your belongings!”
Store
Artwork designed by
Grenoble, Isère, France
View their Store

Customer Reviews

4.9 out of 5 stars rating40 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
40 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ralf K.February 27, 2023 • Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5 out of 5 stars rating
By M.June 14, 2021 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.
5 out of 5 stars rating
By Terra P.November 9, 2020 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!

Tags

Custom-Cut Vinyl Stickers
bigfootstickergiftcryptidmysterycreatureshorrorspookyfolkloreart
All Products
bigfootstickergiftcryptidmysterycreatureshorrorspookyfolkloreart

Other Info

Product ID: 256347585346912819
Designed on 2025-01-24, 9:55 AM
Rating: G