Tap / click on image to see more RealViewsTM
CA$4.80
per sticker
 

Autocollant Bigfoot

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Tiny 5 cm x 5 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 5 cm L x 2.12.7 cm W
  • Design Area: 5 cm L x 5 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Autocollant Bigfoot

Autocollant Bigfoot

Mysterious Bigfoot Sticker - The Guardian of the Forest Add a mystical, wild touch to your collection with this unique Bigfoot sticker. Depicting the legendary man of the woods in an imposing, enigmatic pose. This captivating design is inspired by the darkest and most intriguing tales of the North American forests. With its piercing red eyes and misty surroundings, this Bigfoot evokes a presence both frightening and fascinating.” Dimensions: Ideal size for personalizing laptops, water bottles, notebooks or any smooth surface. Quality material: Water-resistant and durable for extended use. Why buy it? Perfect for fans of folklore, mystery and wilderness adventures. An ideal gift for Bigfoot and cryptid enthusiasts, or anyone who wants a unique and intriguing touch on their personal items. “Bring mystery into your everyday life. Order your Bigfoot sticker today and let this forest guardian protect your belongings!”

Customer Reviews

4.9 out of 5 stars rating40 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
40 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.June 14, 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Terra P.November 9, 2020Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Glossy clear
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!

Tags

Custom-Cut Vinyl Stickers
bigfootstickergiftcryptidmysterycreatureshorrorspookyfolkloreart
All Products
bigfootstickergiftcryptidmysterycreatureshorrorspookyfolkloreart

Other Info

Product ID: 256347585346912819
Designed on 2025-01-24, 9:55 AM
Rating: G