Tap / click on image to see more RealViewsTM
CA$3.35
per sheet
 

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, matte finish

-CA$0.11

About Paper Sheets

Sold by

Size: 21.6 cm x 28 cm

A flat sheet of paper has unlimited possibilities; from flyers to paper airplanes and everything in between, the world is your oyster! Go and conquer.

  • Dimensions: 21.59 cm L x 27.94 cm H (portrait); 27.94 cm L x 21.59 cm H (landscape)
  • High-quality, full-colour, full-bleed printing
  • Print on both sides
  • Add personal photos and text for no additional upcharge
  • Please note that the optional envelopes for this size of paper are larger than standard sized envelopes. The US Postal Service classifies them as Large Envelopes which will require significantly more postage to mail than standard envelopes.
  • 100% satisfaction guarantee
  • Let us print for you! Select your desired quantity for any project big or small

Paper Type: Thin Matte Paper

Your business and personal mailings will have a crisp professional look on this matte. Contains 50% recycled content (10% post-consumer and 40% pre-consumer waste).

About This Design

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

Art Nouveau DIY Christmas Cupcake Wrappers Wraps

These elegant Art Nouveau cupcake wrappers coordinate with the Alphonse Mucha Poinsettia Christmas Collection. Only two are overtly for Christmas, so if you order more than you need for your Christmas party, you can save some for another party on. They would also be lovely for teas, showers, and Valentine parties. This set gives you a mix of orchid cupcake wrappers with fuchsia pink designs and script and orchid cupcake wrappers with fuchsia pink designs and script. Other colorways are available in my gallery. Description: Each sheet contains five different cupcake wrappers featuring Art Nouveau designs with heart, flower and bird motifs. From top down: 1. Floral motif with the words "Yum!" and "Something Yummy" in script. 2. Heart and flower motif. 3. Flower and heart motif with the word "merry" in script repeating across the upper border. 4. Birds and hearts with the word "Joyeux Noël" in script. 5. Bouquets of heart-shaped blossoms with the words "Freshly Baked" and "Cupcake" in script. Instructions: 1. Carefully cut out each wrapper. 2. Bake cupcakes in normal cupcake (muffin tin) liners. 3. Wrap cupcake wrapper around cupcake and secure ends with glue stick, tape or sticker. 4. Frost and decorate cupcakes and add a matching cupcake topper, if you wish. Please visit my gallery's Alphonse Mucha Christmas Poinsettias Collection for more colorways and other matching items.

Customer Reviews

4.5 out of 5 stars rating4.4K Total Reviews
3534 total 5-star reviews394 total 4-star reviews141 total 3-star reviews117 total 2-star reviews263 total 1-star reviews
4,449 Reviews
Reviews for similar products
5 out of 5 stars rating
By Syltina O.February 1, 2022Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Zazzle Reviewer Program
Came on time! Exactly as the picture! Great communication with the seller. She was very patient and helpful. Turned out great. Very thick material. I choose the semi gloss for printing.
4 out of 5 stars rating
By Kaitlyn C.September 20, 2025Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Order itself was perfect except for the delivery. Unfortunately the delivery service left my package in the rain and my cards were slightly damaged from the rain. .
5 out of 5 stars rating
By E.November 3, 2022Verified Purchase
Flat Paper Sheet, Size: 11.4 cm x 14.2 cm, Paper: Basic Semi-Gloss, Envelopes: No Envelopes
Zazzle Reviewer Program
We absolutely loved our card. It arrived on time and looks stunning. We received lots of compliments! All colours turned out perfect!

Tags

Paper Sheets
christmascupcakewrapperswrapsdiychristmas partyholiday partypartyopen housefuchsia
All Products
christmascupcakewrapperswrapsdiychristmas partyholiday partypartyopen housefuchsia

Other Info

Product ID: 244611464883442763
Designed on 2010-12-02, 11:13 PM
Rating: G