Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$4.40
per sticker
 

Alaska Highway Canada - Alaska USA 01 Sticker

4.6 out of 5 stars rating
1090 Total Reviews |
by
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl Sticker
Create your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 7.62 cm L x 8.89 cm H
  • Design Area: 7.62 cm L x 7.62 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317. cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Alaska Highway Canada - Alaska USA 01 Sticker

Alaska Highway Canada - Alaska USA 01 Sticker

The Alaska Highway (also known as the Alaskan Highway, Alaska-Canadian Highway, or ALCAN Highway) was constructed during World War II to connect the contiguous United States to Alaska across Canada. It begins at the junction with several Canadian highways in Dawson Creek, British Columbia, and runs to Delta Junction, Alaska, via Whitehorse, Yukon. When it was completed in 1942 it was about 2,700 kilometres (1,700 mi); but in 2012 it was only 2,232 km (1,387 mi). This is due to constant reconstruction of the highway, which has rerouted and straightened many sections. Once legendary for being a rough, challenging drive, the highway is now paved over its entire length. Its component highways are British Columbia Highway 97, Yukon Highway 1 and Alaska Route 2.
OuterShellUK
Artwork designed by
United Kingdom
View their Store

Customer Reviews

4.6 out of 5 stars rating1.1K Total Reviews
895 total 5-star reviews71 total 4-star reviews28 total 3-star reviews22 total 2-star reviews74 total 1-star reviews
1,090 Reviews
Reviews for similar products
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5 out of 5 stars rating
By Kristin R.January 2, 2020 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
motorcyclemotorcycle road tripsturgisalaska highwayalaskan highwayalcanalaskacanadatravelpannier sticker
All Products
motorcyclemotorcycle road tripsturgisalaska highwayalaskan highwayalcanalaskacanadatravelpannier sticker

Other Info

Product ID: 256829904580003487
Designed on 2026-02-13, 7:27 AM
Rating: G