Tap / click on image to see more RealViewsTM
CA$4.75
per sticker
 

A Wicked Halloween

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

A Wicked Halloween

A Wicked Halloween

These cute black cats wish you a happy halloween!

Customer Reviews

4.9 out of 5 stars rating40 Total Reviews
37 total 5-star reviews2 total 4-star reviews0 total 3-star reviews1 total 2-star reviews0 total 1-star reviews
40 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.June 14, 2021Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The colors were completely accurate, and the stickers are very good quality. The image quality was excellent.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Terra P.November 9, 2020Verified Purchase
15.24 cm x 15.24 cm Custom-Cut Vinyl Stickers, Glossy clear
Zazzle Reviewer Program
They turned out just how I wanted! The font was clear and gave the classic look I was hoping for! Colors were striking and looked just like the picture! I was more than pleased!

Tags

Custom-Cut Vinyl Stickers
catsblack cathalloweenmeowkittykittenwitchanimalspetswink
All Products
catsblack cathalloweenmeowkittykittenwitchanimalspetswink

Other Info

Product ID: 256030144936782471
Designed on 2021-03-18, 1:07 PM
Rating: G