Tap / click on image to see more RealViewsTM
CA$28.20
CA$4.70 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue

Customer Reviews

4.8 out of 5 stars rating3.2K Total Reviews
2877 total 5-star reviews165 total 4-star reviews53 total 3-star reviews28 total 2-star reviews62 total 1-star reviews
3,185 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Andrea P.April 26, 2024Verified Purchase
Custom 26.6 g/m² Tissue, Size: 53.34 cm x 73.66 cm
This picture is absolutely stunning. The picture doesn’t quite do it justice. The detail in the bird is amazing, you’d swear she’s real. Easy to use, arrived quickly. Highly recommend trying this on anything you want to make unique or a conversation piece! Colours are crisp and vivid So pleased with this
5.0 out of 5 stars rating
5 out of 5 stars rating
By Darlene B.December 14, 2021Verified Purchase
Custom 26.6 g/m² Tissue, Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
This decoupage paper looks amazing on the old cedar trunk I refinished. It has made the trunk a special gift for my grandson. The design itself turned out much better than I expected. I am very pleased.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lucy B.December 20, 2021Verified Purchase
Custom 14.8 g/m² Tissue, Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Great quality decoupage paper! I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more. I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more.

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Designed on 2022-01-18, 8:27 PM
Rating: G