Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$12.15
CA$4.05 per sheet of tissue paper
 

2022 Periwinkle Blue Damask Old World Tissue Paper

4.8 out of 5 stars rating
2943 Total Reviews |
by
Qty:
Heads-up!
Sorry, this product is completely sold out.

Other designs from this category

About Tissue Paper

Sold by
Tissue Paper
Create your own from scratch

Size: 25.4 cm x 35.56 cm

When you've gone through the trouble of finding the perfect present make sure it has the perfect presentation. Give your gifts a personal touch with custom tissue paper printed with your chosen artwork or text. Gift giving just went from fun to super-fun!

  • Dimensions: 25.4 cm L x 35.56 cm W
  • Full colour edge-to-edge print
  • 4535g paper is great for wrapping jewellery, small gifts and party favours
  • 8164g paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper

2022 Periwinkle Blue Damask Old World Tissue Paper Periwinkle Damask Old World Tissue Paper 2022 Periwinkle Damask Old World Tissue Paper Damask old world design, damask motif element created by Kristie Hubler, in the 2022 Colour of the Year periwinkle blue, with lighter tone / tint of periwinkle for a background colour. Similar design at https://www.zazzle.com/damask_old_world_cream_yellow_tablecloth-256334957129875231 with different colour damask repeat and background colour. Thank you! Kristie Hubler http://zazzle.com/store/fabricatedframes/products fabricatedframescom@gmail.com damask, "old world", pattern, Mediterranean, periwinkle, vintage, "gift wrap", "tissue paper", blue
FabricatedFrames
Pro
Artwork designed by
Deptford, NJ, United States
View their Store

Customer Reviews

4.8 out of 5 stars rating2.9K Total Reviews
2680 total 5-star reviews153 total 4-star reviews45 total 3-star reviews23 total 2-star reviews42 total 1-star reviews
2,943 Reviews
Reviews for similar products
5 out of 5 stars rating
By Darlene B.December 14, 2021 • Verified Purchase
Custom Tissue Paper - 27 gsm (18lb), Size: 25.4 cm x 35.56 cm
Zazzle Reviewer Program
This decoupage paper looks amazing on the old cedar trunk I refinished. It has made the trunk a special gift for my grandson. The design itself turned out much better than I expected. I am very pleased.
5 out of 5 stars rating
By Tessa M.December 23, 2021 • Verified Purchase
Zazzle Reviewer Program
Gorgeous paper, a little heavier than traditional decoupage tissue, but it worked beautifully on my project nonetheless. Elegant - simple- tres chic! The printing turned out beautifully, it is consistent throughout the entire print with a somewhat faded or mottled coloration. I am in love with this paper.
Original product
5 out of 5 stars rating
By Lucy B.December 20, 2021 • Verified Purchase
Custom Tissue Paper - 15 gsm (10lb), Size: 45.72 cm x 60.96 cm
Zazzle Reviewer Program
Great quality decoupage paper! I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more. I bought this paper to use on a piece of furniture. It was super easy to use and the quality of the image was really good very happy with the product and will continue to purchase more.

Tags

Tissue Paper
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022
All Products
damaskold worldpatternmediterraneanperiwinklevintagegift wraptissue paperblue2022

Other Info

Product ID: 256705250458015326
Designed on 2022-01-18, 8:27 PM
Rating: G